PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3042_f_10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family ARF
Protein Properties Length: 698aa    MW: 77039 Da    PI: 6.6386
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3042_f_10genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.95.2e-25143244199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f k+ltpsd++++g +++pk++a+e+       ++++  ++l+ +d++g +W++++iyr++++r++lt+GW+ Fv +++L +gD ++F   + ++
  Neem_3042_f_10 143 FSKKLTPSDTSTHGGFSVPKRHADEClppldmAQDPPL-QELVANDLHGMEWRFRHIYRGQPKRHLLTSGWSVFVTSKKLVAGDACIFL--RGEN 234
                     88*****************************8444444.59************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+v+r+
  Neem_3042_f_10 235 GELRVGVHRA 244
                     99****9986 PP

2Auxin_resp106.62.7e-35269351183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a ha+st+++F+v+Y+P++s++eF+v++++++++ ++ +svG+Rfkmafe+e++ e+r++Gtvvg++++d +rWp S+Wr+Lk
  Neem_3042_f_10 269 AFHAISTGTMFTVYYRPWTSPAEFIVPFNQYMRSAEIDYSVGTRFKMAFEGEECGEQRVAGTVVGIEAIDHIRWPASEWRCLK 351
                     689******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.62E-36134272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.5E-40134256IPR015300DNA-binding pseudobarrel domain
CDDcd100176.24E-23141243No hitNo description
PfamPF023621.2E-22143244IPR003340B3 DNA binding domain
PROSITE profilePS5086312.52143245IPR003340B3 DNA binding domain
SMARTSM010191.9E-23143245IPR003340B3 DNA binding domain
PfamPF065076.6E-33269351IPR010525Auxin response factor
PfamPF023098.8E-7604682IPR033389AUX/IAA domain
PROSITE profilePS5174515.023613694IPR000270PB1 domain
SuperFamilySSF542773.09E-7617682No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MGGVGGEGKE SSTGVSQSRK RMGDALSTKH NQGGKDELYT ELWRACAGPL VYVPRAGDIV  60
YYFLQGHMEQ VEAYTSEDGK MEMPIYNLPP KILCEVVYVQ LKAEAGTDEV FAQITLLPKP  120
KDEPSLEDGD SLPSPPKANV WSFSKKLTPS DTSTHGGFSV PKRHADECLP PLDMAQDPPL  180
QELVANDLHG MEWRFRHIYR GQPKRHLLTS GWSVFVTSKK LVAGDACIFL RGENGELRVG  240
VHRAIKQQNN GSTSVISGHS MQHGILASAF HAISTGTMFT VYYRPWTSPA EFIVPFNQYM  300
RSAEIDYSVG TRFKMAFEGE ECGEQRVAGT VVGIEAIDHI RWPASEWRCL KVRWDAASDT  360
LMRPTRVSPW NIEQIVCNNK KPAPGQNRQK RQRSIDVSSP GFSSLLNNGV LQGQEDPENK  420
AVGIKELGAP KPPLLPYLVS HPNPDWGYMQ IRLENKLHLP IRDKLYLHPN STVSLSGGSI  480
VSSSFPNHWP AAFAPYGVHD NAALSRNFSV PNASSLSSGS QEWRTLELKD ENGTPHAEPK  540
GGSRYMLFGV NLVNSSPELP SPQVATSNEL ESLCSVPPTS QSSVSETIQV SELSKSVSGI  600
PSEKQCKNCC VSRSCTKVLK FGTALGRSVD LTRFHGYDEL IRELDQMFDF RGSLIDGSSG  660
WQIAYTDYEG DIMLIGDYPW QLSSKPAFII VAYANDLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1423637317353Auxin response factor 1
4ldw_A1e-1423637317353Auxin response factor 1
4ldw_B1e-1423637317353Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006479861.20.0PREDICTED: auxin response factor 2-like isoform X1
SwissprotQ94JM31e-165ARFB_ARATH; Auxin response factor 2
TrEMBLA0A067H8T00.0A0A067H8T0_CITSI; Auxin response factor
STRINGVIT_07s0104g01230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157971016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.31e-166auxin response factor 2